Upload Button Icon Add office photos
Engaged Employer

i

This company page is being actively managed by Tata Elxsi Team. If you also belong to the team, you can get access from here

Tata Elxsi Verified Tick

Compare button icon Compare button icon Compare

Filter interviews by

Tata Elxsi Product Specialist Interview Questions and Answers

Updated 29 Jul 2024

Tata Elxsi Product Specialist Interview Experiences

1 interview found

Interview experience
4
Good
Difficulty level
-
Process Duration
-
Result
-
Round 1 - Technical 

(2 Questions)

  • Q1. Brief introduction along with relevant work done with tools in telecom domain
  • Q2. Explain about TMF Open API with an exaple
  • Ans. 

    TMF Open API is a set of APIs provided by TM Forum for accessing and integrating with their platform.

    • TMF Open API allows developers to access TM Forum's platform for various purposes such as data retrieval, service provisioning, and network management.

    • Developers can use TMF Open API to integrate their own applications with TM Forum's platform, enabling seamless communication and data exchange.

    • An example of using TMF Op...

  • Answered by AI
Round 2 - Technical 

(2 Questions)

  • Q1. Explain about your day to day impacts on the project currently aligned to
  • Ans. 

    My day to day impacts on the project involve analyzing customer feedback, conducting market research, and collaborating with cross-functional teams.

    • Analyze customer feedback to identify areas for improvement

    • Conduct market research to stay updated on industry trends

    • Collaborate with cross-functional teams to ensure project goals are met

  • Answered by AI
  • Q2. Who are the clients and what's your interaction level with them
  • Ans. 

    The clients are typically businesses or individuals who use our products, and my interaction level with them varies depending on the situation.

    • Clients can range from small businesses to large corporations

    • I interact with clients through product demonstrations, training sessions, and troubleshooting support

    • Regular communication with clients to gather feedback and address any concerns

    • Building and maintaining strong relati...

  • Answered by AI

Interview questions from similar companies

Interview experience
5
Excellent
Difficulty level
-
Process Duration
-
Result
Selected Selected
Round 1 - Technical 

(1 Question)

  • Q1. C#, ASP.NER,SQL
Round 2 - Technical 

(1 Question)

  • Q1. Project related, C#,ASp.NET,Javascript,JQuery,SQL
Round 3 - HR 

(1 Question)

  • Q1. Behavioral, Salary discusssion
Interview experience
1
Bad
Difficulty level
Moderate
Process Duration
Less than 2 weeks
Result
-

I applied via Naukri.com and was interviewed in Oct 2024. There were 2 interview rounds.

Round 1 - Technical 

(3 Questions)

  • Q1. How do you handle difficult stakeholders?
  • Q2. Insurance policy lifecycle
  • Q3. Simple Join sql query
Round 2 - Technical 

(2 Questions)

  • Q1. Difference between BA and PO
  • Ans. 

    Business Analyst (BA) focuses on understanding business needs and requirements, while Product Owner (PO) focuses on defining and prioritizing product features.

    • BA analyzes business processes and systems to identify areas for improvement, while PO works closely with stakeholders to define product features and prioritize the product backlog.

    • BA typically works on multiple projects simultaneously, while PO is dedicated to a...

  • Answered by AI
  • Q2. No relevant questions in 2nd round

Interview Preparation Tips

Interview preparation tips for other job seekers - Never ever join persistent.From the start of the interview was not listening and rude. They are recruiting for some silly useless projects and when I asked about domain and work timing he became further angry and asked why I was keen on the domain and said you have to work with clients across the globe and be flexible. He didn't have any idea on the diff between product owner and scrum master and kept showing attitude throughout the interview. It was clearly evident that the fellow didn't have any knowledge.He didn't know for which role he is interviewing even. HR also don't talk properly.. Disconnects the call while we are talking
Interview experience
5
Excellent
Difficulty level
-
Process Duration
-
Result
-
Round 1 - One-on-one 

(2 Questions)

  • Q1. What is name of company
  • Q2. Why you want to work here
Interview experience
1
Bad
Difficulty level
Moderate
Process Duration
6-8 weeks
Result
Selected Selected

I applied via Referral and was interviewed in Jun 2024. There were 2 interview rounds.

Round 1 - Coding Test 

1 hour, wage question, not related to mention technology.

Round 2 - Technical 

(2 Questions)

  • Q1. Oops related queries
  • Q2. Discussion around last project

Interview Preparation Tips

Interview preparation tips for other job seekers - Try in some better organization
Interview experience
5
Excellent
Difficulty level
Moderate
Process Duration
-
Result
-

I was interviewed in Dec 2023.

Round 1 - Technical 

(2 Questions)

  • Q1. Basics on theory of plastics
  • Q2. Basics on Knowledge on mould design concepts
Round 2 - Tool test 

(1 Question)

  • Q1. With in given time given design have to be designed. Dont have to rush but must follow fitting procedure /steps in design process.

Interview Preparation Tips

Interview preparation tips for other job seekers - Basics have to perfect. Know design concepts & constraints used in practical world.
Interview experience
4
Good
Difficulty level
-
Process Duration
-
Result
-
Round 1 - Assignment 

Assignment given by senior executives to solve in interview

Round 2 - Case Study 

Case study round by senior executives

Interview Preparation Tips

Interview preparation tips for other job seekers - Easy process.
Interview experience
3
Average
Difficulty level
Moderate
Process Duration
More than 8 weeks
Result
No response

I applied via Naukri.com and was interviewed before Oct 2022. There were 2 interview rounds.

Round 1 - Resume Shortlist 
Pro Tip by AmbitionBox:
Keep your resume crisp and to the point. A recruiter looks at your resume for an average of 6 seconds, make sure to leave the best impression.
View all tips
Round 2 - One-on-one 

(3 Questions)

  • Q1. The sile thodi der me when you are free video face change the previous year figures of paisa hai to send to me when you are free video face
  • Q2. There is no i need to know when you are free video face change the previous year figures of paisa hai to send to me when you are free video face change the previous year figures of
  • Q3. Aasaannahihekyacompanymemmakharsirpleasefindthe

Interview Preparation Tips

Interview preparation tips for other job seekers - Gf to send to me when you are free video face change the time at the end of the day of the day of the day of the day of the day you are free video

I applied via Campus Placement and was interviewed in Jun 2022. There were 2 interview rounds.

Round 1 - Resume Shortlist 
Pro Tip by AmbitionBox:
Don’t add your photo or details such as gender, age, and address in your resume. These details do not add any value.
View all tips
Round 2 - HR 

(1 Question)

  • Q1. What about your skills

Interview Preparation Tips

Interview preparation tips for other job seekers - This is a secure company and also provides many facilities and I have suggest in freshers company provide the laptop in some people's
Round 1 - HR 

(7 Questions)

  • Q1. What are your salary expectations?
  • Q2. What is your family background?
  • Q3. Share details of your previous job.
  • Q4. Why should we hire you?
  • Q5. Where do you see yourself in 5 years?
  • Q6. What are your strengths and weaknesses?
  • Q7. Tell me about yourself.

Interview Preparation Tips

Interview preparation tips for other job seekers - In one word it was outstanding

Tata Elxsi Interview FAQs

How many rounds are there in Tata Elxsi Product Specialist interview?
Tata Elxsi interview process usually has 2 rounds. The most common rounds in the Tata Elxsi interview process are Technical.

Tell us how to improve this page.

Tata Elxsi Product Specialist Interview Process

based on 1 interview

Interview experience

4
  
Good
View more

Interview Questions from Similar Companies

Wipro Interview Questions
3.7
 • 5.6k Interviews
Tech Mahindra Interview Questions
3.5
 • 3.8k Interviews
HCLTech Interview Questions
3.5
 • 3.8k Interviews
LTIMindtree Interview Questions
3.8
 • 2.9k Interviews
DXC Technology Interview Questions
3.7
 • 795 Interviews
Mphasis Interview Questions
3.4
 • 788 Interviews
Nagarro Interview Questions
4.0
 • 759 Interviews
NTT Data Interview Questions
3.9
 • 614 Interviews
View all
Tata Elxsi Product Specialist Salary
based on 13 salaries
₹9.2 L/yr - ₹19 L/yr
45% more than the average Product Specialist Salary in India
View more details

Tata Elxsi Product Specialist Reviews and Ratings

based on 5 reviews

4.0/5

Rating in categories

3.7

Skill development

3.6

Work-life balance

3.7

Salary

4.3

Job security

3.5

Company culture

3.7

Promotions

3.5

Work satisfaction

Explore 5 Reviews and Ratings
Senior Engineer
4.4k salaries
unlock blur

₹3.5 L/yr - ₹14 L/yr

Specialist
2.6k salaries
unlock blur

₹7.5 L/yr - ₹25 L/yr

Engineer
1.4k salaries
unlock blur

₹2.8 L/yr - ₹9 L/yr

Senior Software Engineer
1k salaries
unlock blur

₹4 L/yr - ₹15 L/yr

Software Engineer
642 salaries
unlock blur

₹3 L/yr - ₹9 L/yr

Explore more salaries
Compare Tata Elxsi with

TCS

3.7
Compare

Wipro

3.7
Compare

HCLTech

3.5
Compare

Tech Mahindra

3.5
Compare
Did you find this page helpful?
Yes No
write
Share an Interview