Interview Questions

  • Reviews
  • Salaries
  • Interview Questions
  • About Company
  • Benefits
  • Jobs
  • Office Photos
+ Contribute
notification
notification
Login
Upload Button Icon Add office photos
Engaged Employer

i

This company page is being actively managed by Tata Elxsi Team. If you also belong to the team, you can get access from here

Tata Elxsi Verified Tick

Compare button icon Compare button icon Compare
3.9

based on 2k Reviews

Filter interviews by

Tata Elxsi Product Specialist Interview Questions and Answers

Updated 29 Jul 2024

Tata Elxsi Product Specialist Interview Experiences

1 interview found

Product Specialist Interview Questions & Answers

user image Anonymous

posted on 29 Jul 2024

Interview experience
4
Good
Difficulty level
-
Process Duration
-
Result
-
Round 1 - Technical 

(2 Questions)

  • Q1. Brief introduction along with relevant work done with tools in telecom domain
    • Add your answer
  • Q2. Explain about TMF Open API with an exaple
  • Ans. 

    TMF Open API is a set of APIs provided by TM Forum for accessing and integrating with their platform.

    • TMF Open API allows developers to access TM Forum's platform for various purposes such as data retrieval, service provisioning, and network management.

    • Developers can use TMF Open API to integrate their own applications with TM Forum's platform, enabling seamless communication and data exchange.

    • An example of using TMF Op...

    • Answered by AI
    Add your answer
Round 2 - Technical 

(2 Questions)

  • Q1. Explain about your day to day impacts on the project currently aligned to
  • Ans. 

    My day to day impacts on the project involve analyzing customer feedback, conducting market research, and collaborating with cross-functional teams.

    • Analyze customer feedback to identify areas for improvement

    • Conduct market research to stay updated on industry trends

    • Collaborate with cross-functional teams to ensure project goals are met

    • Answered by AI
    Add your answer
  • Q2. Who are the clients and what's your interaction level with them
  • Ans. 

    The clients are typically businesses or individuals who use our products, and my interaction level with them varies depending on the situation.

    • Clients can range from small businesses to large corporations

    • I interact with clients through product demonstrations, training sessions, and troubleshooting support

    • Regular communication with clients to gather feedback and address any concerns

    • Building and maintaining strong relati...

    • Answered by AI
    Add your answer

Top trending discussions

View All
Career Growth
2w
a system engineer
New Job Anxiety?
Hey all I recently got an offer from a company as it offered me a 60-70 % hike over my current company which was about to secure a job. I am having 3 years of experience in SAP BW domain and mostly and in this I have worked for 1.6 years in BW support and that too in night shifts where there is not much work. I started preparing interviews and cleared them and now got an offer and I put my notice and my last working day was next week. Now coming to the main part even though I'm good about most part having less real time experience and exposure is freaking me out and what will be the new company expectations and I decided to work hard to learn all the details it's just the hands on I'm not sure. With in mean time I'll be preparing in that company I mean once I join should I need to tell my lead or manager that this is at where am I and should I just bluff them as i know everything. Any suggestions please...the joining date is around the corner which gives me more anxiety
Got a question about Tata Elxsi?
Ask anonymously on communities.

Interview questions from similar companies

Product Specialist Interview Questions & Answers

LTIMindtree user image Anonymous

posted on 21 Sep 2024

Interview experience
5
Excellent
Difficulty level
-
Process Duration
-
Result
Selected Selected
Round 1 - Technical 

(1 Question)

  • Q1. C#, ASP.NER,SQL
    • Add your answer
Round 2 - Technical 

(1 Question)

  • Q1. Project related, C#,ASp.NET,Javascript,JQuery,SQL
    • Add your answer
Round 3 - HR 

(1 Question)

  • Q1. Behavioral, Salary discusssion
    • Add your answer

Product Manager Interview Questions & Answers

Persistent Systems user image Anonymous

posted on 22 Nov 2024

Interview experience
1
Bad
Difficulty level
Moderate
Process Duration
Less than 2 weeks
Result
-

I applied via Naukri.com and was interviewed in Oct 2024. There were 2 interview rounds.

Round 1 - Technical 

(3 Questions)

  • Q1. How do you handle difficult stakeholders?
    • Add your answer
  • Q2. Insurance policy lifecycle
    • Add your answer
  • Q3. Simple Join sql query
    • Add your answer
Round 2 - Technical 

(2 Questions)

  • Q1. Difference between BA and PO
  • Ans. 

    Business Analyst (BA) focuses on understanding business needs and requirements, while Product Owner (PO) focuses on defining and prioritizing product features.

    • BA analyzes business processes and systems to identify areas for improvement, while PO works closely with stakeholders to define product features and prioritize the product backlog.

    • BA typically works on multiple projects simultaneously, while PO is dedicated to a...

    • Answered by AI
    Add your answer
  • Q2. No relevant questions in 2nd round
    • Add your answer

Interview Preparation Tips

Interview preparation tips for other job seekers - Never ever join persistent.From the start of the interview was not listening and rude. They are recruiting for some silly useless projects and when I asked about domain and work timing he became further angry and asked why I was keen on the domain and said you have to work with clients across the globe and be flexible. He didn't have any idea on the diff between product owner and scrum master and kept showing attitude throughout the interview. It was clearly evident that the fellow didn't have any knowledge.He didn't know for which role he is interviewing even. HR also don't talk properly.. Disconnects the call while we are talking

Product Manager Interview Questions & Answers

eClerx user image Anonymous

posted on 8 Jan 2025

Interview experience
5
Excellent
Difficulty level
-
Process Duration
-
Result
-
Round 1 - One-on-one 

(2 Questions)

  • Q1. What is name of company
    • Add your answer
  • Q2. Why you want to work here
    • Add your answer

Production Manager Interview Questions & Answers

GlobalLogic user image Anonymous

posted on 19 Jul 2024

Interview experience
1
Bad
Difficulty level
Moderate
Process Duration
6-8 weeks
Result
Selected Selected

I applied via Referral and was interviewed in Jun 2024. There were 2 interview rounds.

Round 1 - Coding Test 

1 hour, wage question, not related to mention technology.

Round 2 - Technical 

(2 Questions)

  • Q1. Oops related queries
    • Add your answer
  • Q2. Discussion around last project
    • Add your answer

Interview Preparation Tips

Interview preparation tips for other job seekers - Try in some better organization

Product Manager Interview Questions & Answers

Publicis Sapient user image Anonymous

posted on 23 Mar 2024

Interview experience
4
Good
Difficulty level
-
Process Duration
-
Result
Selected Selected
Round 1 - One-on-one 

(1 Question)

  • Q1. 1. About oil industry and what products we have worked and explain some product / feature which are new / different
    • Add your answer
Round 2 - Case Study 

Comprises many questions related to MTM, Costing methods, price changes, in transit oil price calculations with a case history.

Round 3 - One-on-one 

(1 Question)

  • Q1. 1. Questions based on case study 2. Questions related to past experience with DB, technology we have worked, related to product management
    • Add your answer
Round 4 - One-on-one 

(1 Question)

  • Q1. 1. More of a culture fit questions
    • Add your answer
Round 5 - HR 

(1 Question)

  • Q1. Asked About what we know about Sapient, Why we are leaving the previous org etc.
    • Add your answer

Product Engineer Interview Questions & Answers

Cyient user image Anonymous

posted on 13 Jan 2024

Interview experience
5
Excellent
Difficulty level
Moderate
Process Duration
-
Result
-

I was interviewed in Dec 2023.

Round 1 - Technical 

(2 Questions)

  • Q1. Basics on theory of plastics
    • Add your answer
  • Q2. Basics on Knowledge on mould design concepts
    • Add your answer
Round 2 - Tool test 

(1 Question)

  • Q1. With in given time given design have to be designed. Dont have to rush but must follow fitting procedure /steps in design process.
    • Add your answer

Interview Preparation Tips

Interview preparation tips for other job seekers - Basics have to perfect. Know design concepts & constraints used in practical world.

Production Engineer Interview Questions & Answers

L&T Technology Services user image Anonymous

posted on 16 Oct 2023

Interview experience
3
Average
Difficulty level
Moderate
Process Duration
More than 8 weeks
Result
No response

I applied via Naukri.com and was interviewed before Oct 2022. There were 2 interview rounds.

Round 1 - Resume Shortlist 
Pro Tip by AmbitionBox:
Keep your resume crisp and to the point. A recruiter looks at your resume for an average of 6 seconds, make sure to leave the best impression.
View all tips
Round 2 - One-on-one 

(3 Questions)

  • Q1. The sile thodi der me when you are free video face change the previous year figures of paisa hai to send to me when you are free video face
    • Add your answer
  • Q2. There is no i need to know when you are free video face change the previous year figures of paisa hai to send to me when you are free video face change the previous year figures of
    • Add your answer
  • Q3. Aasaannahihekyacompanymemmakharsirpleasefindthe
    • Add your answer

Interview Preparation Tips

Interview preparation tips for other job seekers - Gf to send to me when you are free video face change the time at the end of the day of the day of the day of the day of the day you are free video

Production Interview Questions & Answers

Mphasis user image Anonymous

posted on 1 Jul 2022

I applied via Campus Placement and was interviewed in Jun 2022. There were 2 interview rounds.

Round 1 - Resume Shortlist 
Pro Tip by AmbitionBox:
Don’t add your photo or details such as gender, age, and address in your resume. These details do not add any value.
View all tips
Round 2 - HR 

(1 Question)

  • Q1. What about your skills
    • Add your answer

Interview Preparation Tips

Interview preparation tips for other job seekers - This is a secure company and also provides many facilities and I have suggest in freshers company provide the laptop in some people's

Production Supervisor Interview Questions & Answers

Sutherland Global Services user image Anonymous

posted on 24 Feb 2022

Round 1 - HR 

(7 Questions)

  • Q1. What are your salary expectations?
    • Add your answer
  • Q2. What is your family background?
    • Add your answer
  • Q3. Share details of your previous job.
    • Add your answer
  • Q4. Why should we hire you?
    • Add your answer
  • Q5. Where do you see yourself in 5 years?
    • Add your answer
  • Q6. What are your strengths and weaknesses?
    • Add your answer
  • Q7. Tell me about yourself.
    • Add your answer

Interview Preparation Tips

Interview preparation tips for other job seekers - In one word it was outstanding
More about working at Tata Elxsi

Tata Elxsi Interview FAQs

How many rounds are there in Tata Elxsi Product Specialist interview?
Tata Elxsi interview process usually has 2 rounds. The most common rounds in the Tata Elxsi interview process are Technical.

Tell us how to improve this page.

Tata Elxsi Interviews By Designations

Interview Questions for Popular Designations

Interview Questions from Similar Companies

Wipro Interview Questions
3.7
 • 5.5k Interviews
Tech Mahindra Interview Questions
3.6
 • 3.8k Interviews
HCLTech Interview Questions
3.5
 • 3.7k Interviews
LTIMindtree Interview Questions
3.9
 • 2.9k Interviews
DXC Technology Interview Questions
3.7
 • 801 Interviews
Mphasis Interview Questions
3.4
 • 787 Interviews
Nagarro Interview Questions
4.0
 • 761 Interviews
Hexaware Technologies Interview Questions
3.6
 • 709 Interviews
Publicis Sapient Interview Questions
3.5
 • 603 Interviews
Persistent Systems Interview Questions
3.5
 • 601 Interviews
View all

Fast track your campus placements

Thiagarajar College of Engineering, Madurai Placement Questions
3 Interviews
Velammal Engineering College, Chennai Placement Questions
3 Interviews
BNM Institute of Technology, Bangalore Placement Questions
2 Interviews
NSS College of Engineering, Palakkad Placement Questions
1 Interview
Birla Institute of Technology (BIT), Ranchi Placement Questions
1 Interview
R N S Institute of Technology, Bangalore Placement Questions
1 Interview
Centre for Development of Advanced Computing (CDAC) Placement Questions
1 Interview
View all
Tata Elxsi Product Specialist Salary
based on 20 salaries
₹9.2 L/yr - ₹19 L/yr
45% more than the average Product Specialist Salary in India
View more details

Tata Elxsi Product Specialist Reviews and Ratings

based on 5 reviews

4.0/5

Rating in categories

3.7

Skill development

3.7

Work-Life balance

3.7

Salary & Benefits

4.3

Job Security

3.5

Company culture

3.7

Promotions/Appraisal

3.5

Work Satisfaction

Explore 5 Reviews and Ratings
Tata Elxsi Salaries in India
Senior Engineer
4.2k salaries
unlock blur

₹3.5 L/yr - ₹14 L/yr

Specialist
2.5k salaries
unlock blur

₹7.5 L/yr - ₹25 L/yr

Engineer
1.3k salaries
unlock blur

₹2.8 L/yr - ₹8.2 L/yr

Senior Software Engineer
982 salaries
unlock blur

₹4 L/yr - ₹15 L/yr

Software Engineer
632 salaries
unlock blur

₹3 L/yr - ₹9.5 L/yr

Explore more salaries
Compare Tata Elxsi with

TCS

3.7
Compare

Wipro

3.7
Compare

HCLTech

3.5
Compare

Tech Mahindra

3.6
Compare

Calculate your in-hand salary

Confused about how your in-hand salary is calculated? Enter your annual salary (CTC) and get your in-hand salary
Did you find this page helpful?
Yes No
write
Share an Interview