Search

Interview Questions

  • Reviews
  • Salaries
  • Interview Questions
  • About Company
  • Benefits
  • Jobs
  • Office Photos
  • Community
+ Contribute
notification
notification
Login
Upload Button Icon Add office photos
Employer? Claim Account for FREE

L&T Technology Services

Compare button icon Compare button icon Compare
3.3

based on 5.1k Reviews

Play video Play video Video summary

Filter interviews by

L&T Technology Services Production Engineer Interview Questions and Answers

Updated 16 Oct 2023

L&T Technology Services Production Engineer Interview Experiences

1 interview found

Production Engineer Interview Questions & Answers

user image Anonymous

posted on 16 Oct 2023

Interview experience
3
Average
Difficulty level
Moderate
Process Duration
More than 8 weeks
Result
No response

I applied via Naukri.com and was interviewed before Oct 2022. There were 2 interview rounds.

Round 1 - Resume Shortlist 
Pro Tip by AmbitionBox:
Keep your resume crisp and to the point. A recruiter looks at your resume for an average of 6 seconds, make sure to leave the best impression.
View all tips
Round 2 - One-on-one 

(3 Questions)

  • Q1. The sile thodi der me when you are free video face change the previous year figures of paisa hai to send to me when you are free video face
    • Add your answer
  • Q2. There is no i need to know when you are free video face change the previous year figures of paisa hai to send to me when you are free video face change the previous year figures of
    • Add your answer
  • Q3. Aasaannahihekyacompanymemmakharsirpleasefindthe
    • Add your answer

Interview Preparation Tips

Interview preparation tips for other job seekers - Gf to send to me when you are free video face change the time at the end of the day of the day of the day of the day of the day you are free video

Interview questions from similar companies

Senior Engineer Interview Questions & Answers

LTIMindtree user image Anonymous

posted on 26 May 2021

I applied via Naukri.com and was interviewed in Nov 2020. There were 5 interview rounds.

Interview Questionnaire 

2 Questions

  • Q1. Questions based on the CV we kept
    • Add your answer
  • Q2. Questions related to powershell, storages, networking in azure IaaS, NSG
    • Add your answer

Interview Preparation Tips

Interview preparation tips for other job seekers - Prepare whatever u kept in CV and the basics

Senior Engineer Interview Questions & Answers

LTIMindtree user image Anonymous

posted on 27 Jul 2022

I applied via Job Portal and was interviewed before Jul 2021. There were 3 interview rounds.

Round 1 - Technical 

(3 Questions)

  • Q1. How do you configure and verify custom DNS in Azure AD?
  • Ans. 

    To configure and verify custom DNS in Azure AD, follow these steps:

    • Create a DNS zone in Azure DNS

    • Add a custom domain to Azure AD

    • Create a CNAME record in the DNS zone that points to the Azure AD domain

    • Verify the custom domain in Azure AD

    • Update the DNS registrar to use the Azure DNS name servers

    • Test the custom DNS by accessing Azure AD resources using the custom domain

    • Answered by AI
    Add your answer
  • Q2. Supported authentication types in Azure AD
  • Ans. 

    Azure AD supports various authentication types for secure access to resources.

    • Azure AD supports password-based authentication, multi-factor authentication, certificate-based authentication, and federated authentication.

    • It also supports OAuth 2.0 and OpenID Connect for secure authentication and authorization.

    • Examples of supported protocols include SAML, WS-Federation, and OAuth 2.0/OpenID Connect.

    • Azure AD also supports ...

    • Answered by AI
    Add your answer
  • Q3. Hybrid scenarios regarding Azure AD using Azure AD Connect
    • Add your answer
Round 2 - One-on-one 

(3 Questions)

  • Q1. What if someone asks you your salary?
    • Add your answer
  • Q2. How would you react if someone lured into giving up some secrets
    • Add your answer
  • Q3. Are you ready for relocation??
    • Add your answer
Round 3 - HR 

(4 Questions)

  • Q1. Salary discussion, Joining bonus discussion
    • Add your answer
  • Q2. Explanation of salary breakup in hand
    • Add your answer
  • Q3. Any gaps in education, experience explanation
    • Add your answer
  • Q4. Confirmation about previous work experiences
    • Add your answer

Interview Preparation Tips

Topics to prepare for LTIMindtree Senior Engineer interview:
  • Azure Active Directory
  • Azure
  • Deployments in Azure
Interview preparation tips for other job seekers - If they want the opening to be filled immediately, then they will anyhow select you if you have even 30% to 40% of the required skillset required for the job and good communication. If your previous experiences are from startups, then also they will consider you. But if they are willing to wait for your notice period to end and offering you desired salary, beware then they will crunch the best out of you during interviews, they will ensure that they are hiring the right person.

Skills evaluated in this interview

Senior Engineer Interview Questions & Answers

Nagarro user image Anonymous

posted on 23 Jul 2021

I applied via Recruitment Consultant and was interviewed before Jul 2020. There were 7 interview rounds.

Interview Questionnaire 

1 Question

  • Q1. 1. Question regarding Spring boot micro service and JPA, 2. Collections questions like contract between equals and hashcode, Array vs list etc
    • Add your answer

Interview Preparation Tips

Interview preparation tips for other job seekers - Nothing too hard. If you are bit well and springboot and core java you will definitely be able crack the interview.

Senior Engineer Interview Questions & Answers

Nagarro user image Anonymous

posted on 11 Apr 2021

I applied via LinkedIn and was interviewed in Oct 2020. There were 6 interview rounds.

Interview Questionnaire 

1 Question

  • Q1. Questions on 1.agile methodology 2.testing techniques 3.test planning 4.previous project work 5.api testing 6.basic sql queries
    • Add your answer

Senior Engineer Interview Questions & Answers

Nagarro user image Anonymous

posted on 22 May 2021

I applied via Naukri.com and was interviewed in Nov 2020. There were 4 interview rounds.

Interview Questionnaire 

1 Question

  • Q1. Well normal questions asked about my working experience and couple of tech quests.
    • Add your answer

Senior Engineer Interview Questions & Answers

Nagarro user image Anonymous

posted on 3 Jan 2022

I applied via Recruitment Consultant and was interviewed before Jan 2021. There were 4 interview rounds.

Interview Questionnaire 

6 Questions

  • Q1. Design Patterns
    • Add your answer
  • Q2. Solid Principles
    • Add your answer
  • Q3. MVC Routing
    • Add your answer
  • Q4. Asp.Net WebAPI Http protocols
    • Add your answer
  • Q5. SQL Server Read/Insert/Update/Delete/ queries and Sub queries
    • Add your answer
  • Q6. HackerRank Test
    • Add your answer

Interview Preparation Tips

Interview preparation tips for other job seekers - Practice string manipulation, arrays and list manipulation for hackerrank test

Senior Engineer Interview Questions & Answers

LTIMindtree user image Anonymous

posted on 22 Feb 2022

I applied via Naukri.com and was interviewed before Feb 2021. There were 2 interview rounds.

Round 1 - Case Study 
Round 2 - Group Discussion 
Pro Tip by AmbitionBox:
Don’t treat group discussions as an argument. Group discussion is about reaching a meaningful conclusion.
View all tips

Interview Preparation Tips

Interview preparation tips for other job seekers - Interview process is smooth and majorly asked direct questions and some scenarios

Senior Engineer Interview Questions & Answers

LTIMindtree user image Anonymous

posted on 20 Jun 2024

Interview experience
5
Excellent
Difficulty level
Moderate
Process Duration
2-4 weeks
Result
Selected Selected

I applied via Naukri.com and was interviewed before Jun 2023. There was 1 interview round.

Round 1 - Technical 

(2 Questions)

  • Q1. CI-CD Architecture
    • Add your answer
  • Q2. Kubernetes Architecture
    • Add your answer

Senior Engineer Interview Questions & Answers

LTIMindtree user image Anonymous

posted on 20 Dec 2024

Interview experience
5
Excellent
Difficulty level
Moderate
Process Duration
6-8 weeks
Result
Selected Selected

I applied via Walk-in and was interviewed before Dec 2023. There were 2 interview rounds.

Round 1 - One-on-one 

(2 Questions)

  • Q1. About technical question related string, array coding
    • Add your answer
  • Q2. Oops concept
    • Add your answer
Round 2 - HR 

(2 Questions)

  • Q1. Tell about myself
  • Ans. 

    I am a Senior Engineer with 10+ years of experience in software development, specializing in backend systems and cloud technologies.

    • 10+ years of experience in software development

    • Specialize in backend systems and cloud technologies

    • Strong problem-solving skills

    • Experience leading and mentoring junior engineers

    • Answered by AI
    Add your answer
  • Q2. My strength and weakness
    • Add your answer
More about working at L&T Technology Services

L&T Technology Services Interview FAQs

How many rounds are there in L&T Technology Services Production Engineer interview?
L&T Technology Services interview process usually has 2 rounds. The most common rounds in the L&T Technology Services interview process are Resume Shortlist and One-on-one Round.
How to prepare for L&T Technology Services Production Engineer interview?
Go through your CV in detail and study all the technologies mentioned in your CV. Prepare at least two technologies or languages in depth if you are appearing for a technical interview at L&T Technology Services. The most common topics and skills that interviewers at L&T Technology Services expect are CCTV Monitoring, Lean Manufacturing, 3D Modeling, AutoCAD and Automation Testing.
What are the top questions asked in L&T Technology Services Production Engineer interview?

Some of the top questions asked at the L&T Technology Services Production Engineer interview -

  1. There is no i need to know when you are free video face change the previous yea...read more
  2. The sile thodi der me when you are free video face change the previous year fig...read more
  3. Aasaannahihekyacompanymemmakharsirpleasefind...read more

Tell us how to improve this page.

L&T Technology Services Interviews By Designations

Interview Questions for Popular Designations

L&T Technology Services Production Engineer Interview Process

based on 1 interview

Interview experience

3
  
Average
View more

Interview Questions from Similar Companies

LTIMindtree Interview Questions
3.7
 • 2.9k Interviews
Mphasis Interview Questions
3.4
 • 812 Interviews
DXC Technology Interview Questions
3.7
 • 804 Interviews
Nagarro Interview Questions
4.0
 • 765 Interviews
Hexaware Technologies Interview Questions
3.5
 • 726 Interviews
Sutherland Global Services Interview Questions
3.6
 • 645 Interviews
NTT Data Interview Questions
3.8
 • 631 Interviews
Optum Global Solutions Interview Questions
4.0
 • 626 Interviews
Publicis Sapient Interview Questions
3.5
 • 623 Interviews
Persistent Systems Interview Questions
3.5
 • 610 Interviews
View all

Fast track your campus placements

Lovely Professional University (LPU) Placement Questions
3 Interviews
SRM Institute of Science & Technology, Chennai Placement Questions
3 Interviews
Jawaharlal Nehru Technological University (JNTU) Placement Questions
2 Interviews
Sri Krishna College of Engineering and Technology, Coimbatore Placement Questions
2 Interviews
Sri Vasavi Engineering College, Tadepalligudem Placement Questions
2 Interviews
Sardar Vallabhbhai National Institute of Technology (NIT), Surat Placement Questions
2 Interviews
KIIT University, Bhuvaneshwar Placement Questions
1 Interview
View all
L&T Technology Services Production Engineer Salary
based on 11 salaries
₹4.3 L/yr - ₹11.5 L/yr
77% more than the average Production Engineer Salary in India
View more details
L&T Technology Services Salaries in India
Senior Engineer
5.9k salaries
unlock blur

₹5 L/yr - ₹17.1 L/yr

Engineer
4.6k salaries
unlock blur

₹2.6 L/yr - ₹8.2 L/yr

Technical Lead
2.2k salaries
unlock blur

₹8.5 L/yr - ₹30 L/yr

Project Lead
1.5k salaries
unlock blur

₹6 L/yr - ₹22.1 L/yr

Software Engineer
1.4k salaries
unlock blur

₹2.8 L/yr - ₹9.8 L/yr

Explore more salaries
Compare L&T Technology Services with

LTIMindtree

3.7
Compare

DXC Technology

3.7
Compare

Mphasis

3.4
Compare

Sutherland Global Services

3.5
Compare
Popular Calculators
Are you paid fairly?
Monthly In-hand Salary Calculator
Gratuity Calculator
HRA Calculator
Salary Hike Calculator
Did you find this page helpful?
Yes No
write
Share an Interview