Interview Questions

  • Reviews
  • Salaries
  • Interview Questions
  • About Company
  • Benefits
  • Jobs
  • Office Photos
+ Contribute
notification
notification
Login
Upload Button Icon Add office photos
Employer? Claim Account for FREE

L&T Technology Services

Compare button icon Compare button icon Compare
3.3

based on 4.5k Reviews

Filter interviews by

L&T Technology Services Production Engineer Interview Questions and Answers

Updated 16 Oct 2023

L&T Technology Services Production Engineer Interview Experiences

1 interview found

Production Engineer Interview Questions & Answers

user image Anonymous

posted on 16 Oct 2023

Interview experience
3
Average
Difficulty level
Moderate
Process Duration
More than 8 weeks
Result
No response

I applied via Naukri.com and was interviewed before Oct 2022. There were 2 interview rounds.

Round 1 - Resume Shortlist 
Pro Tip by AmbitionBox:
Keep your resume crisp and to the point. A recruiter looks at your resume for an average of 6 seconds, make sure to leave the best impression.
View all tips
Round 2 - One-on-one 

(3 Questions)

  • Q1. The sile thodi der me when you are free video face change the previous year figures of paisa hai to send to me when you are free video face
    • Add your answer
  • Q2. There is no i need to know when you are free video face change the previous year figures of paisa hai to send to me when you are free video face change the previous year figures of
    • Add your answer
  • Q3. Aasaannahihekyacompanymemmakharsirpleasefindthe
    • Add your answer

Interview Preparation Tips

Interview preparation tips for other job seekers - Gf to send to me when you are free video face change the time at the end of the day of the day of the day of the day of the day you are free video

Production Engineer Jobs at L&T Technology Services

View all

Top trending discussions

View All
Engineering - Software & QA
2w (edited)
unsurpassedalbert
Verified Icon
·
works at
TCS
Trying to switch after 8 years
I have been working in IT INDUSTRY for 8 years in the same Company I always thought about stability and a secure job that's the reason. I never tried to switch but now due to family expenses I need to change companies in any conditions. Please can anybody suggest the companies with the same stability and security of jobs in the IT sector Worked in the following domains till now Hitech domain Banking(BFSI) domain Telecom - Verizon
Got a question about L&T Technology Services?
Ask anonymously on communities.

Interview questions from similar companies

Production Engineer Interview Questions & Answers

GlobalLogic user image Anonymous

posted on 26 Apr 2024

Interview experience
4
Good
Difficulty level
Moderate
Process Duration
Less than 2 weeks
Result
Selected Selected

I applied via Naukri.com and was interviewed before Apr 2023. There were 2 interview rounds.

Round 1 - Technical 

(2 Questions)

  • Q1. Related to digital marketing
    • Add your answer
  • Q2. Data base related
    • Add your answer
Round 2 - HR 

(1 Question)

  • Q1. To check communication skills
    • Add your answer

Production Manager Interview Questions & Answers

GlobalLogic user image Anonymous

posted on 19 Jul 2024

Interview experience
1
Bad
Difficulty level
Moderate
Process Duration
6-8 weeks
Result
Selected Selected

I applied via Referral and was interviewed in Jun 2024. There were 2 interview rounds.

Round 1 - Coding Test 

1 hour, wage question, not related to mention technology.

Round 2 - Technical 

(2 Questions)

  • Q1. Oops related queries
    • Add your answer
  • Q2. Discussion around last project
    • Add your answer

Interview Preparation Tips

Interview preparation tips for other job seekers - Try in some better organization

Production Engineer Interview Questions & Answers

GlobalLogic user image Anonymous

posted on 26 Apr 2024

Interview experience
4
Good
Difficulty level
Moderate
Process Duration
Less than 2 weeks
Result
Selected Selected

I applied via Naukri.com and was interviewed before Apr 2023. There were 2 interview rounds.

Round 1 - Technical 

(2 Questions)

  • Q1. Related to digital marketing
    • Add your answer
  • Q2. Data base related
    • Add your answer
Round 2 - HR 

(1 Question)

  • Q1. To check communication skills
    • Add your answer

Production Interview Questions & Answers

Mphasis user image Anonymous

posted on 1 Jul 2022

I applied via Campus Placement and was interviewed in Jun 2022. There were 2 interview rounds.

Round 1 - Resume Shortlist 
Pro Tip by AmbitionBox:
Keep your resume crisp and to the point. A recruiter looks at your resume for an average of 6 seconds, make sure to leave the best impression.
View all tips
Round 2 - HR 

(1 Question)

  • Q1. What about your skills
    • Add your answer

Interview Preparation Tips

Interview preparation tips for other job seekers - This is a secure company and also provides many facilities and I have suggest in freshers company provide the laptop in some people's

Production Supervisor Interview Questions & Answers

Sutherland Global Services user image Anonymous

posted on 24 Feb 2022

Round 1 - HR 

(7 Questions)

  • Q1. What are your salary expectations?
    • Add your answer
  • Q2. What is your family background?
    • Add your answer
  • Q3. Share details of your previous job.
    • Add your answer
  • Q4. Why should we hire you?
    • Add your answer
  • Q5. Where do you see yourself in 5 years?
    • Add your answer
  • Q6. What are your strengths and weaknesses?
    • Add your answer
  • Q7. Tell me about yourself.
    • Add your answer

Interview Preparation Tips

Interview preparation tips for other job seekers - In one word it was outstanding

Production Manager Interview Questions & Answers

DXC Technology user image Anonymous

posted on 5 Jan 2022

I applied via Referral and was interviewed in Jul 2021. There were 5 interview rounds.

Interview Questionnaire 

1 Question

  • Q1. What if civil engineering will suit for production manager of dxc technology ؟
  • Ans. 

    Civil engineering may not be the ideal background for a production manager role in DXC Technology.

    • Production management requires knowledge of technology and software development

    • Civil engineering focuses on construction and infrastructure

    • However, transferable skills such as project management and problem-solving may be useful

    • Experience in manufacturing or software development would be more relevant

    • DXC Technology may hav

    • Answered by AI
    Add your answer

Interview Preparation Tips

Interview preparation tips for other job seekers - I want to testy skills and my knowledge and communication skills. Basically, I'm civil engineering department (B. tech) , I want to computer basics related tropics.
More about working at L&T Technology Services

L&T Technology Services Interview FAQs

How many rounds are there in L&T Technology Services Production Engineer interview?
L&T Technology Services interview process usually has 2 rounds. The most common rounds in the L&T Technology Services interview process are Resume Shortlist and One-on-one Round.
How to prepare for L&T Technology Services Production Engineer interview?
Go through your CV in detail and study all the technologies mentioned in your CV. Prepare at least two technologies or languages in depth if you are appearing for a technical interview at L&T Technology Services. The most common topics and skills that interviewers at L&T Technology Services expect are CCTV Monitoring, 3D Modeling, AutoCAD, Automation Testing and Costing.
What are the top questions asked in L&T Technology Services Production Engineer interview?

Some of the top questions asked at the L&T Technology Services Production Engineer interview -

  1. There is no i need to know when you are free video face change the previous yea...read more
  2. The sile thodi der me when you are free video face change the previous year fig...read more
  3. Aasaannahihekyacompanymemmakharsirpleasefind...read more

Tell us how to improve this page.

L&T Technology Services Interviews By Designations

Interview Questions for Popular Designations

Production Engineer Interview Questions from Similar Companies

TCS Production Engineer Interview Questions
3.7
 • 8 Interviews
Wipro Production Engineer Interview Questions
3.7
 • 7 Interviews
Tech Mahindra Production Engineer Interview Questions
3.6
 • 3 Interviews
HCLTech Production Engineer Interview Questions
3.5
 • 3 Interviews
Infosys Production Engineer Interview Questions
3.7
 • 1 Interview
GlobalLogic Production Engineer Interview Questions
3.7
 • 1 Interview
Hewlett Packard Enterprise Production Engineer Interview Questions
4.2
 • 1 Interview
Societe Generale Global Solution Centre Production Engineer Interview Questions
3.9
 • 1 Interview
View all

Fast track your campus placements

Lovely Professional University (LPU) Placement Questions
3 Interviews
SRM Institute of Science & Technology, Chennai Placement Questions
3 Interviews
Sri Krishna College of Engineering and Technology, Coimbatore Placement Questions
2 Interviews
Sri Vasavi Engineering College, Tadepalligudem Placement Questions
2 Interviews
Sardar Vallabhbhai National Institute of Technology (NIT), Surat Placement Questions
2 Interviews
Jawaharlal Nehru Technological University (JNTU) Placement Questions
2 Interviews
PES School of Engineering, Bangalore Placement Questions
1 Interview
View all
L&T Technology Services Production Engineer Salary
based on 11 salaries
₹4.3 L/yr - ₹11.5 L/yr
78% more than the average Production Engineer Salary in India
View more details
Production Engineer Jobs at L&T Technology Services
Production Engineer

Bangalore / Bengaluru

4-7 Yrs

Not Disclosed

production engineer

Chennai

5-10 Yrs

Not Disclosed

Explore more jobs
L&T Technology Services Salaries in India
Senior Engineer
5.3k salaries
unlock blur

₹5 L/yr - ₹17 L/yr

Engineer
4.7k salaries
unlock blur

₹3 L/yr - ₹8.2 L/yr

Technical Lead
2k salaries
unlock blur

₹8.5 L/yr - ₹28 L/yr

Project Lead
1.6k salaries
unlock blur

₹6 L/yr - ₹22.1 L/yr

Senior Software Engineer
1.4k salaries
unlock blur

₹4.8 L/yr - ₹18.2 L/yr

Explore more salaries
Compare L&T Technology Services with

TCS

3.7
Compare

Infosys

3.7
Compare

Wipro

3.7
Compare

Tech Mahindra

3.6
Compare
Popular Calculators
Are you paid fairly?
Monthly In-hand Salary Calculator
Gratuity Calculator
HRA Calculator
Salary Hike Calculator
Did you find this page helpful?
Yes No
write
Share an Interview